Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin (Adipoq)

Product Specifications

Product Name Alternative

30KDA adipocyte complement-related protein; Adipocyte complement-related 30KDA protein ; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ

Abbreviation

Recombinant Mouse Adipoq protein

Gene Name

Adipoq

UniProt

Q60994

Expression Region

18-247aa

Organism

Mus musculus (Mouse)

Target Sequence

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue rodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Molecular Weight

28.9 kDa

References & Citations

Testosterone selectively reduces the high molecular weight form of adiponectin by inhibiting its secretion from adipocytes.Xu A., Chan K.W., Hoo R.L.C., Wang Y., Tan K.C.B., Zhang J., Chen B., Lam M.C., Tse C., Cooper G.J.S., Lam K.S.L.J. Biol. Chem. 280:18073-18080 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FBXW7 Polyclonal Antibody
RD211064A-01 20 µL

FBXW7 Polyclonal Antibody

Ask
View Details
FBXW7 Polyclonal Antibody
RD211064A-02 60 μL

FBXW7 Polyclonal Antibody

Ask
View Details
FBXW7 Polyclonal Antibody
RD211064A-03 120 μL

FBXW7 Polyclonal Antibody

Ask
View Details
FBXW7 Polyclonal Antibody
RD211064A-04 200 µL

FBXW7 Polyclonal Antibody

Ask
View Details
Recombinant Coxiella burnetii Aspartate 1-decarboxylase (panD)
MBS7091331-01 0.05 mg (E-Coli)

Recombinant Coxiella burnetii Aspartate 1-decarboxylase (panD)

Ask
View Details
Recombinant Coxiella burnetii Aspartate 1-decarboxylase (panD)
MBS7091331-02 0.2 mg (E-Coli)

Recombinant Coxiella burnetii Aspartate 1-decarboxylase (panD)

Ask
View Details