Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Allergin-1 (Milr1), partial

Product Specifications

Product Name Alternative

Allergy inhibitory receptor 1 Mast cell antigen 32 Short name: MCA-32 Short name: Mast cell Ag-32 Mast cell immunoglobulin-like receptor 1 Gm885, Mca32

Abbreviation

Recombinant Mouse Milr1 protein, partial

Gene Name

Milr1

UniProt

Q3TB92

Expression Region

34-150aa

Organism

Mus musculus (Mouse)

Target Sequence

ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.

Molecular Weight

20.1 kDa

References & Citations

"An immunoglobulin-like receptor, Allergin-1, inhibits immunoglobulin E-mediated immediate hypersensitivity reactions." Hitomi K., Tahara-Hanaoka S., Someya S., Fujiki A., Tada H., Sugiyama T., Shibayama S., Shibuya K., Shibuya A. Nat. Immunol. 11:601-607 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane
PC1016877-01 250 mg

(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane

Sign In for Pricing
View Details
(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane
PC1016877-02 500 mg

(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane

Sign In for Pricing
View Details
(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane
PC1016877-03 1 g

(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane

Sign In for Pricing
View Details
(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane
PC1016877-04 5 g

(2-Fluoro-3-methoxy-5- (trifluoromethyl) phenyl) (methyl) sulfane

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/2297R) [DyLight 650]
NBP3-08918C 100 µL

Rabbit Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/2297R) [DyLight 650]

Sign In for Pricing
View Details
RPL36P15 3'UTR Luciferase Stable Cell Line
TU021532 1.0 mL

RPL36P15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details