Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial

Product Specifications

Product Name Alternative

AaLta lktA

Abbreviation

Recombinant Aggregatibacter actinomycetemcomitans ltxA protein, partial

Gene Name

LtxA

UniProt

P16462

Expression Region

721-1055aa

Organism

Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans)

Target Sequence

IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNKKTISPQELAGLIKNKGKSSSLMSSSRSSSMLTQKSGLSNDISRIISATSGFGSSGKALSASPLQTNNNFNSYANSLATTA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media.

Molecular Weight

38.3 kDa

References & Citations

"Analysis of the Actinobacillus actinomycetemcomitans leukotoxin gene. Delineation of unique features and comparison to homologous toxins." Lally E.T., Golub E.E., Kieba I.R., Taichman N.S., Rosenbloom J., Rosenbloom J.C., Gibson C.W., Demuth D.R. J. Biol. Chem. 264:15451-15456 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nobox Rabbit Polyclonal Antibody
TA363247 100 µL

Nobox Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)
MBS1315648-01 0.02 mg (E-Coli)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)
MBS1315648-02 0.02 mg (Yeast)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)
MBS1315648-03 0.1 mg (E-Coli)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)
MBS1315648-04 0.1 mg (Yeast)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)
MBS1315648-05 0.02 mg (Baculovirus)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni ATP synthase subunit beta (atpD)

Ask
View Details