Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

Basic fibroblast growth factor Short name: bFGF Heparin-binding growth factor 2 Short name: HBGF-2

Abbreviation

Recombinant Human FGF2 protein

Gene Name

FGF2

UniProt

P09038

Expression Region

143-288aa

Organism

Homo sapiens (Human)

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis

Molecular Weight

32.4 kDa

References & Citations

"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ON Antibody Pair Set
E-KAB-0249 50 µL & 100 µg

Human ON Antibody Pair Set

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF405S conjugate, 0.1mg/mL
BNC040393-500 1x 500 µL

Cytokeratin, multi (C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GNAI3 (NM_006496) Human Over-expression Lysate
LC401948 20 µg

GNAI3 (NM_006496) Human Over-expression Lysate

Sign In for Pricing
View Details
Lusvertikimab Biosimilar - Research Grade
ICH5183-20mg 20 mg

Lusvertikimab Biosimilar - Research Grade

Sign In for Pricing
View Details
SRD5A3 Human Gene Knockout Kit (CRISPR)
KN400970 1 Kit

SRD5A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Transketolase (TKT) Rabbit Polyclonal Antibody
TA369419 100 µL

Transketolase (TKT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details