Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Heme oxygenase 1 (Hmox1)

Product Specifications

Product Name Alternative

HSP32

Abbreviation

Recombinant Rat Hmox1 protein

Gene Name

Hmox1

UniProt

P06762

Expression Region

1-289aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Molecular Weight

35 kDa

References & Citations

"Crystal structure of rat apo-heme oxygenase-1 (HO-1) : mechanism of heme binding in HO-1 inferred from structural comparison of the apo and heme complex forms." Sugishima M., Sakamoto H., Kakuta Y., Omata Y., Hayashi S., Noguchi M., Fukuyama K. Biochemistry 41:7293-7300 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Testis
CS634344 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3194), CF640R conjugate, 0.1mg/mL
BNC403194-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3194), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STOM (N-term) Goat Polyclonal Antibody
AP32348PU-N 100 µg

STOM (N-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
EVA1 (MPZL2) (NM_144765) Human Recombinant Protein
TP323753M 100 µg

EVA1 (MPZL2) (NM_144765) Human Recombinant Protein

Sign In for Pricing
View Details
IDI1 Polyclonal Antibody
E-AB-90689-01 60 µL

IDI1 Polyclonal Antibody

Sign In for Pricing
View Details
IDI1 Polyclonal Antibody
E-AB-90689-02 120 µL

IDI1 Polyclonal Antibody

Sign In for Pricing
View Details