Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin O (CTSO)

Product Specifications

Product Name Alternative

CTSO1

Abbreviation

Recombinant Human CTSO protein

Gene Name

CTSO

UniProt

P43234

Expression Region

108-321aa

Organism

Homo sapiens (Human)

Target Sequence

LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Molecular Weight

28.5 kDa

References & Citations

"Human cathepsin O. Molecular cloning from a breast carcinoma, production of the active enzyme in Escherichia coli, and expression analysis in human tissues." Velasco G., Ferrando A.A., Puente X.S., Sanchez L.M., Lopez-Otin C. J. Biol. Chem. 269:27136-27142 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CXCR4 Antibody (30L4) [Alexa Fluor 350]
NBP2-22006AF350 0.1 mL

Rat Monoclonal CXCR4 Antibody (30L4) [Alexa Fluor 350]

Sign In for Pricing
View Details
RPSAP55 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2068306 1.0 µg DNA

RPSAP55 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
VEZF1 Over-expression Lysate Product
GWB-2DCCE8 0.1 mg

VEZF1 Over-expression Lysate Product

Sign In for Pricing
View Details
TRPV4 Human qPCR Primer Pair (NM_021625)
HP214185 200 Reactions

TRPV4 Human qPCR Primer Pair (NM_021625)

Sign In for Pricing
View Details
CK039 rabbit pAb
MBS8599287-01 0.1 mL

CK039 rabbit pAb

Sign In for Pricing
View Details
CK039 rabbit pAb
MBS8599287-02 0.1 mL (AF405L)

CK039 rabbit pAb

Sign In for Pricing
View Details