Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial

Product Specifications

Product Name Alternative

Amplified in breast cancer protein 1 ABC1

Abbreviation

Recombinant Human HEATR6 protein, partial

Gene Name

HEATR6

UniProt

Q6AI08

Expression Region

1052-1175aa

Organism

Homo sapiens (Human)

Target Sequence

KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Amplification-dependent oncogene.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Amplification-dependent oncogene.

Molecular Weight

18.5 kDa

References & Citations

"Structural analysis of the 17q22-23 amplicon identifies several independent targets of amplification in breast cancer cell lines and tumors." Wu G.-J., Sinclair C., Hinson S., Ingle J.N., Roche P.C., Couch F.J. Cancer Res. 61:4951-4955 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR4 (Toll Like Receptor 4, Toll-like Receptor 4 Precursor, TLR 4, CD284, CD284 Antigen, Homolog of Drosophila Toll, hToll, Toll (Drosophila) Homolog, TOLL, Toll Endotoxin Hyporesponsiveness)
T8050-33 100 µg

TLR4 (Toll Like Receptor 4, Toll-like Receptor 4 Precursor, TLR 4, CD284, CD284 Antigen, Homolog of Drosophila Toll, hToll, Toll (Drosophila) Homolog, TOLL, Toll Endotoxin Hyporesponsiveness)

Sign In for Pricing
View Details
Incenp 3'UTR GFP Stable Cell Line
TU160114 1.0 mL

Incenp 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CDC20 Recombinant Protein (Human)
RP006475 100 µg

CDC20 Recombinant Protein (Human)

Sign In for Pricing
View Details
Magic™ Membrane Protein Mouse Elovl7 (ELOVL family member 7, elongation of long chain fatty acids (yeast)) Expressed in vitro E.coli expression system, Full Length
MPX2911K Each

Magic™ Membrane Protein Mouse Elovl7 (ELOVL family member 7, elongation of long chain fatty acids (yeast)) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum Octanoyltransferase (lipB)
MBS1153850-01 0.02 mg (E-Coli)

Recombinant Corynebacterium glutamicum Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum Octanoyltransferase (lipB)
MBS1153850-02 0.1 mg (E-Coli)

Recombinant Corynebacterium glutamicum Octanoyltransferase (lipB)

Sign In for Pricing
View Details