Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3

Product Specifications

Product Name Alternative

L-rhamnose-binding lectin CSL3

Abbreviation

Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3 protein

UniProt

P86179

Expression Region

1-195aa

Organism

Oncorhynchus keta (Chum salmon) (Salmo keta)

Target Sequence

AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.

Molecular Weight

27 kDa

References & Citations

"Isolation and characterization of L-rhamnose-binding lectins from chum salmon (Oncorhynchus keta) eggs." Shiina N., Tateno H., Ogawa T., Muramoto K., Saneyoshi M., Kamiya H. Fish. Sci. 68:1352-1366 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI4F8]
CF814507 100 µg

SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI4F8]

Sign In for Pricing
View Details
S-(4-Nitrobenzyl)-6-thioinosine
TRC-N493695-25MG 25 mg

S-(4-Nitrobenzyl)-6-thioinosine

Sign In for Pricing
View Details
QK1 (QKI) (NM_206854) Human Over-expression Lysate
LC403731 20 µg

QK1 (QKI) (NM_206854) Human Over-expression Lysate

Sign In for Pricing
View Details
XCL1 Antibody
KC-8295-01 50 μL

XCL1 Antibody

Sign In for Pricing
View Details
XCL1 Antibody
KC-8295-02 100 µL

XCL1 Antibody

Sign In for Pricing
View Details
XCL1 Antibody
KC-8295-03 1 mL

XCL1 Antibody

Sign In for Pricing
View Details