Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial

Product Specifications

Product Name Alternative

MHC class I antigen A*1 HLAA

Abbreviation

Recombinant Human HLA-A protein, partial

Gene Name

HLA-A

UniProt

P30443

Expression Region

25-308aa

Organism

Homo sapiens (Human)

Target Sequence

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the presentation of foreign antigens to the immune system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the presentation of foreign antigens to the immune system.

Molecular Weight

36.7 kDa

References & Citations

"A generic sequencing based typing approach for the identification of HLA-A diversity." Sitha S., Scheltinga S.A., Johnston-Dow L.A., White C.B., der van Zwan A.W., Bakema J.E., Rozemuller E.H., van der Tweel J.G., Kronink M.N., Tilanus M.G.J. Hum. Immunol. 57:120-128 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PODXL Mouse Monoclonal Antibody [Clone ID: 3D3]
AM32857PU-S 100 µg

PODXL Mouse Monoclonal Antibody [Clone ID: 3D3]

Sign In for Pricing
View Details
FBXL5 Rabbit Polyclonal Antibody
TA376151 100 µL

FBXL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gas Chromatography-Mass Spectrometry BCHR-110
BCHR-110 1 Unit

Gas Chromatography-Mass Spectrometry BCHR-110

Sign In for Pricing
View Details
Natriuretic Peptide Receptor A (NPR1) (N-term) Rabbit Polyclonal Antibody
AP15071PU-N 400 µL

Natriuretic Peptide Receptor A (NPR1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF647 conjugate, 0.1mg/mL
BNC470201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RTL9 activation kit by CRISPRa
GA111562 1 Kit

Human RTL9 activation kit by CRISPRa

Sign In for Pricing
View Details