Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycophorin-A (GYPA), partial

Product Specifications

Product Name Alternative

MN sialoglycoprotein; PAS-2Sialoglycoprotein alpha; CD235a

Abbreviation

Recombinant Human GYPA protein, partial

Gene Name

GYPA

UniProt

A0A0C4DFT7

Expression Region

20-91aa

Organism

Homo sapiens (Human)

Target Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Glycophorin A is the major intrinsic mbrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte mbrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma mbrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175) ; binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12 kDa

References & Citations

Hsa, an adhesin of Streptococcus gordonii DL1, binds to alpha2-3-linked sialic acid on glycophorin A of the erythrocyte membrane.Yajima A., Urano-Tashiro Y., Shimazu K., Takashima E., Takahashi Y., Konishi K.Microbiol. Immunol. 52:69-77 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3AP31 3'UTR GFP Stable Cell Line
TU071758 1.0 mL

RPS3AP31 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ACAD9 Human qPCR Template Standard (NM_014049)
HK200511 1 Kit

ACAD9 Human qPCR Template Standard (NM_014049)

Sign In for Pricing
View Details
Car13 Protein Vector (Mouse) (pPB-C-His)
PV161510 500 ng

Car13 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CRTAC1 Protein Vector (Mouse) (pPB-N-His)
PV168139 500 ng

CRTAC1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ARCN1 (Coatomer Subunit delta, Archain, Delta-coat Protein, Delta-COP, COPD)
123460 50 µg

ARCN1 (Coatomer Subunit delta, Archain, Delta-coat Protein, Delta-COP, COPD)

Sign In for Pricing
View Details
RPS12P22 3'UTR Luciferase Stable Cell Line
TU021946 1.0 mL

RPS12P22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details