Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Scrapie-responsive protein 1 (SCRG1)

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein ; ScRG-1

Abbreviation

Recombinant Human SCRG1 protein

Gene Name

SCRG1

UniProt

O75711

Expression Region

21-98aa

Organism

Homo sapiens (Human)

Target Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.9 kDa

References & Citations

Characterization of the human analogue of a scrapie-responsive gene.Dron M., Dandoy-Dron F., Guillo F., Benboudjema L., Hauw J.-J., Lebon P., Dormont D., Tovey M.G.J. Biol. Chem. 273:18015-18018 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf74 (C-term) Rabbit Polyclonal Antibody
AP50438PU-N 400 µL

C11orf74 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FLJ31958 Human qPCR Primer Pair (NM_153030)
HP218028 200 Reactions

FLJ31958 Human qPCR Primer Pair (NM_153030)

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS631709 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
Zfp146 Mouse Gene Knockout Kit (CRISPR)
KN519735 1 Kit

Zfp146 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS802262 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Frozen Tissue Sections, Metastasis, unknown source
CS621294 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details