Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial

Product Specifications

Product Name Alternative

PETE; Plastocyanin; chloroplastic

Abbreviation

Recombinant Spinacia oleracea PETE protein, partial

Gene Name

PETE

UniProt

P00289

Expression Region

70-168aa

Organism

Spinacia oleracea (Spinach)

Target Sequence

VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.

Molecular Weight

26.4 kDa

References & Citations

"Plastocyanin is encoded by an uninterrupted nuclear gene in spinach." Rother C., Jansen T., Tyagi A., Tittgen J., Herrmann R.G. Curr. Genet. 11:171-176 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2S1 Human Gene Knockout Kit (CRISPR)
KN402919 1 Kit

AP2S1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]
TA500599AM 100 µL

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]

Sign In for Pricing
View Details
Recombinant Human Sonic Hedgehog/SHH Protein
PKSH033519-01 10 µg

Recombinant Human Sonic Hedgehog/SHH Protein

Sign In for Pricing
View Details
Recombinant Human Sonic Hedgehog/SHH Protein
PKSH033519-02 50 µg

Recombinant Human Sonic Hedgehog/SHH Protein

Sign In for Pricing
View Details
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF594 conjugate, 0.1mg/mL
BNC943168-100 1x 100 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Mouse CD49d (PS/2) In Vivo Antibody - Low Endotoxin
ICH1200-25mg 25 mg

Anti-Mouse CD49d (PS/2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details