Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridioides difficile Toxin A (toxA), partial

Product Specifications

Product Name Alternative

TcdA

Abbreviation

Recombinant Clostridioides difficile toxA protein, partial

Gene Name

ToxA

UniProt

P16154

Expression Region

2387-2710aa

Organism

Clostridioides difficile (Peptoclostridium difficile)

Target Sequence

ASTGYTSINGKHFYFNTDGIMQIGVFKGPNGFEYFAPANTDANNIEGQAILYQNKFLTLNGKKYYFGSDSKAVTGLRTIDGKKYYFNTNTAVAVTGWQTINGKKYYFNTNTSIASTGYTIISGKHFYFNTDGIMQIGVFKGPDGFEYFAPANTDANNIEGQAIRYQNRFLYLHDNIYYFGNNSKAATGWVTIDGNRYYFEPNTAMGANGYKTIDNKNFYFRNGLPQIGVFKGSNGFEYFAPANTDANNIEGQAIRYQNRFLHLLGKIYYFGNNSKAVTGWQTINGKVYYFMPDTAMAAAGGLFEIDGVIYFFGVDGVKAPGIYG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Only after the enteral delivery of the enterotoxin A may the characteristic disease called pseudomembranous colitis be induced.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Only after the enteral delivery of the enterotoxin A may the characteristic disease called pseudomembranous colitis be induced.

Molecular Weight

40.1 kDa

References & Citations

"Clostridium difficile toxin glucosyltransferase domains in complex with a non-hydrolyzable UDP-glucose analogue." Alvin J.W., Lacy D.B. J. Struct. Biol. 198:203-209 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig HSPA1A / Heat shock 70 kDa protein 1A Recombinant Protein
R0873p 1 Each

Pig HSPA1A / Heat shock 70 kDa protein 1A Recombinant Protein

Sign In for Pricing
View Details
GTF2IRD2 Rabbit Polyclonal Antibody (Cy3)
orb979755 100 µL

GTF2IRD2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) APC
MBS6135508-01 0.1 mL

BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) APC

Sign In for Pricing
View Details
BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) APC
MBS6135508-02 5x 0.1 mL

BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) APC

Sign In for Pricing
View Details
Toll-like receptor 2
MBS7043445-01 0.02 mg

Toll-like receptor 2

Sign In for Pricing
View Details
Toll-like receptor 2
MBS7043445-02 0.1 mg

Toll-like receptor 2

Sign In for Pricing
View Details