Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Odorant-binding protein

Product Specifications

Product Name Alternative

Olfactory mucosa pyrazine-binding protein

Abbreviation

Recombinant Bovine Odorant-binding protein

UniProt

P07435

Expression Region

1-159aa

Organism

Bos taurus (Bovine)

Target Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This protein binds a wide variety of chemical odorants.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This protein binds a wide variety of chemical odorants.

Molecular Weight

18.5 kDa

References & Citations

"Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity." Monaco H.L., Zanotti G. Biopolymers 32:457-465 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C3b ELISA Kit
E005749 1 Each

Human C3b ELISA Kit

Sign In for Pricing
View Details
Asparagine synthetase (ASNS) (NM_001178076) Human Tagged ORF Clone Lentiviral Particle
RC230144L3V 200 µL

Asparagine synthetase (ASNS) (NM_001178076) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SMN1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
44455126 3x 1.0µg DNA

SMN1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human Legionella antibody IgG, LP Ab-IgG ELISA Kit
NB-E10600-01 96 Well

Human Legionella antibody IgG, LP Ab-IgG ELISA Kit

Sign In for Pricing
View Details
Human Legionella antibody IgG, LP Ab-IgG ELISA Kit
NB-E10600-02 96 Well

Human Legionella antibody IgG, LP Ab-IgG ELISA Kit

Sign In for Pricing
View Details
JAK2 (Janus Kinase 2) (MaxLight 405) discontinued
J0901-03-ML405 100 µL

JAK2 (Janus Kinase 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details