Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel (mscL)

Product Specifications

Product Name Alternative

MscL; Z4661; ECs4156; Large-conductance mechanosensitive channel

Abbreviation

Recombinant E.coli O157:H7 mscL protein

Gene Name

MscL

UniProt

P0A743

Expression Region

1-136aa

Organism

Escherichia coli O157:H7

Target Sequence

MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS

Tag

N-terminal 6xHis-B2M-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell.

Molecular Weight

29 kDa

References & Citations

"Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12."Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K., Han C.-G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T., Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T. Shinagawa H.DNA Res. 8:11-22 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butyramide
GL3233-100g 100 g

Butyramide

Sign In for Pricing
View Details
DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (MaxLight 650)
MBS6227184-01 0.1 mL

DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (MaxLight 650)

Sign In for Pricing
View Details
DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (MaxLight 650)
MBS6227184-02 5x 0.1 mL

DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (MaxLight 650)

Sign In for Pricing
View Details
Fascin, ID (Singed-like Protein, 55kD Actin-bundling Protein, p55, SNL, HSN, FAN1, FSCN1) (MaxLight 490)
MBS6475670-01 0.1 mL

Fascin, ID (Singed-like Protein, 55kD Actin-bundling Protein, p55, SNL, HSN, FAN1, FSCN1) (MaxLight 490)

Sign In for Pricing
View Details
Fascin, ID (Singed-like Protein, 55kD Actin-bundling Protein, p55, SNL, HSN, FAN1, FSCN1) (MaxLight 490)
MBS6475670-02 5x 0.1 mL

Fascin, ID (Singed-like Protein, 55kD Actin-bundling Protein, p55, SNL, HSN, FAN1, FSCN1) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae aat Protein (aa 1-234)
VAng-Cr4625-500gEcoli 500 µg (E. coli)

Recombinant Klebsiella Pneumoniae aat Protein (aa 1-234)

Sign In for Pricing
View Details