Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cancer/testis antigen 2 (CTAG2)

Product Specifications

Product Name Alternative

Autoimmunogenic cancer/testis antigen NY-ESO-2 Cancer/testis antigen 6.2 Short name: CT6.2 L antigen family member 1 Short name: LAGE-1 ESO2, LAGE1

Abbreviation

Recombinant Human CTAG2 protein

Gene Name

CTAG2

UniProt

O75638

Expression Region

1-210aa

Organism

Homo sapiens (Human)

Target Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.1 kDa

References & Citations

"CD4+ Th2 cell recognition of HLA-DR-restricted epitopes derived from CAMEL: a tumor antigen translated in an alternative open reading frame." Slager E.H., Borghi M., van der Minne C.E., Aarnoudse C.A., Havenga M.J., Schrier P.I., Osanto S., Griffioen M. J. Immunol. 170:1490-1497 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYG2
pro-1245 2µg

LYG2

Sign In for Pricing
View Details
Rat Phospholipid Transfer Protein (PLTP) ELISA Kit
abx155987-01 96 Tests

Rat Phospholipid Transfer Protein (PLTP) ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipid Transfer Protein (PLTP) ELISA Kit
abx155987-02 5x 96 Tests

Rat Phospholipid Transfer Protein (PLTP) ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipid Transfer Protein (PLTP) ELISA Kit
abx155987-03 10x 96 Tests

Rat Phospholipid Transfer Protein (PLTP) ELISA Kit

Sign In for Pricing
View Details
ICAM1/CD54 Monoclonal Antibody, PerCP-Cy5.5 Conjugated
bsm-10697M-PerCP-Cy5.5 100 µL

ICAM1/CD54 Monoclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
CPA6 Human shRNA Plasmid Kit (Locus ID 57094)
TL305254 1 Kit

CPA6 Human shRNA Plasmid Kit (Locus ID 57094)

Sign In for Pricing
View Details