Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cold-inducible RNA-binding protein (Cirbp)

Product Specifications

Product Name Alternative

A18 hnRNP Glycine-rich RNA-binding protein CIRP Cirp

Abbreviation

Recombinant Mouse Cirbp protein

Gene Name

Cirbp

UniProt

P60824

Expression Region

1-172aa

Organism

Mus musculus (Mouse)

Target Sequence

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.

Molecular Weight

22.6 kDa

References & Citations

"A glycine-rich RNA-binding protein mediating cold-inducible suppression of mammalian cell growth." Nishiyama H., Itoh K., Kaneko Y., Kishishita M., Yoshida O., Fujita J. J. Cell Biol. 137:899-908 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2IRD2 Human Gene Knockout Kit (CRISPR)
KN424638 1 Kit

GTF2IRD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702023 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CCR6 (NM_004367) Human Over-expression Lysate
LY401394 100 µg

CCR6 (NM_004367) Human Over-expression Lysate

Sign In for Pricing
View Details
P38 gamma/MAPK12 Recombinant Rabbit monoclonal Antibody
HA750892 100 µL

P38 gamma/MAPK12 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
p-Cresol
TRC-C781900-2.5G 2.5 g

p-Cresol

Sign In for Pricing
View Details
MAPT / TAU pThr181 Rabbit Polyclonal Antibody
AP01709PU-N 100 µg

MAPT / TAU pThr181 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details