Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial

Product Specifications

Product Name Alternative

5E6 Lymphocyte antigen 49c Short name: Ly-49c Nk2.1 T-cell surface glycoprotein Ly-49C Ly-49c, Ly49C

Abbreviation

Recombinant Mouse Klra3 protein, partial

Gene Name

Klra3

UniProt

Q64329

Expression Region

70-266aa

Organism

Mus musculus (Mouse)

Target Sequence

QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Receptor on natural killer (NK) cells for class I MHC.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor on natural killer (NK) cells for class I MHC.

Molecular Weight

27.6 kDa

References & Citations

"Ly-49 multigene family. New members of a superfamily of type II membrane proteins with lectin-like domains." Wong S., Freeman J.D., Kelleher C., Mager D., Takei F. J. Immunol. 147:1417-1423 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin K19 antibody
10R-2383 5 mL

Keratin K19 antibody

Sign In for Pricing
View Details
Angelic Acid Methyl Ester
441570 500 mg

Angelic Acid Methyl Ester

Sign In for Pricing
View Details
GluR1 Rabbit Polyclonal Antibody (Cy5.5)
orb1010686 100 µL

GluR1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
R-Spondin3 Double Nickase Plasmid (h)
sc-404472-NIC 20 µg

R-Spondin3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Polyclonal Antibody to Ubiquitin Like Modifier Activating Enzyme 2 (UBA2)
MBS2139760-01 0.1 mL

Polyclonal Antibody to Ubiquitin Like Modifier Activating Enzyme 2 (UBA2)

Sign In for Pricing
View Details
Polyclonal Antibody to Ubiquitin Like Modifier Activating Enzyme 2 (UBA2)
MBS2139760-02 0.2 mL

Polyclonal Antibody to Ubiquitin Like Modifier Activating Enzyme 2 (UBA2)

Sign In for Pricing
View Details