Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Outer capsid protein VP4, partial

Product Specifications

Product Name Alternative

Hemagglutinin

Abbreviation

Recombinant Rotavirus A Outer capsid protein VP4 protein, partial

UniProt

P17465

Expression Region

248-480aa

Organism

Rotavirus A (strain RVA/Cow/United States/NCDV-Lincoln/1969/G6P6[1]) (RV-A) (Rotavirus A (strain Nebraska calf diarrhea virus) )

Target Sequence

AQPNQDIVVSKTSLWKEMQYNRDIVIRFKFANSIIKSGGLGYKWSEVSFKPANYQYTYTRDGEEVTAHTTCSVNGINDFNYNGGSLPTDFVISKYEVIKENSFVYIDYWDDSQAFRNMVNVRSLAADLNSVMCTGGDYSFALPVGNYPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLSVEEPPFSILRTRVSGLYGLPAARPNNSQEYYEIAGRFSLISLVPSNDDY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. According to the considered strain, VP4 seems to essentially target sialic acid and/or the integrin heterodimer ITGA2/ITGB1

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. According to the considered strain, VP4 seems to essentially target sialic acid and/or the integrin heterodimer ITGA2/ITGB1 (By similarity) .

Molecular Weight

33.2 kDa

References & Citations

"Comparative analysis of the VP3 gene of divergent strains of the rotaviruses simian SA11 and bovine Nebraska calf diarrhea virus." Nishikawa K., Taniguchi K., Torres A., Hoshino Y., Green K.Y., Kapikian A.Z., Chanock R.M., Gorziglia M. J. Virol. 62:4022-4026 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Survival motor neuron protein (SMN1) ELISA Kit
MBS2802034-01 48 Tests

Human Survival motor neuron protein (SMN1) ELISA Kit

Ask
View Details
Human Survival motor neuron protein (SMN1) ELISA Kit
MBS2802034-02 96 Tests

Human Survival motor neuron protein (SMN1) ELISA Kit

Ask
View Details
Human Survival motor neuron protein (SMN1) ELISA Kit
MBS2802034-03 5x 96 Tests

Human Survival motor neuron protein (SMN1) ELISA Kit

Ask
View Details
Human Survival motor neuron protein (SMN1) ELISA Kit
MBS2802034-04 10x 96 Tests

Human Survival motor neuron protein (SMN1) ELISA Kit

Ask
View Details
Rabbit Monoclonal Uroplakin Ib Antibody (UPK1B/8976R) [FITC]
NBP3-24141F 0.1 mL

Rabbit Monoclonal Uroplakin Ib Antibody (UPK1B/8976R) [FITC]

Ask
View Details
DYDC1 (NM_138812) Human Tagged ORF Clone
RG205409 10 µg

DYDC1 (NM_138812) Human Tagged ORF Clone

Ask
View Details