Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Resistin (RETN)

Product Specifications

Product Name Alternative

RSTN

Abbreviation

Recombinant Bovine RETN protein

Gene Name

RETN

UniProt

Q762I5

Expression Region

19-109aa

Organism

Bos taurus (Bovine)

Target Sequence

QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes (By similarity) .

Molecular Weight

25.6 kDa

References & Citations

"Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers." Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S. Anim. Sci. J. 76:567-573 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASTOR1 (NM_001037666) Human Recombinant Protein
E45H39149M5 20 µg

CASTOR1 (NM_001037666) Human Recombinant Protein

Sign In for Pricing
View Details
Bephenium Hydroxynaphthoate
MBS575691 Inquire

Bephenium Hydroxynaphthoate

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)
MBS2106713-01 0.1 mL

HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)
MBS2106713-02 0.2 mL

HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)
MBS2106713-03 0.5 mL

HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)
MBS2106713-04 1 mL

HRP-Linked Polyclonal Antibody to Glutathione Peroxidase 1 (GPX1)

Sign In for Pricing
View Details