Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Resistin (RETN)

Product Specifications

Product Name Alternative

RSTN

Abbreviation

Recombinant Bovine RETN protein

Gene Name

RETN

UniProt

Q762I5

Expression Region

19-109aa

Organism

Bos taurus (Bovine)

Target Sequence

QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes (By similarity) .

Molecular Weight

25.6 kDa

References & Citations

"Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers." Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S. Anim. Sci. J. 76:567-573 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GSTU3 Polyclonal Antibody
MBS9017592 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GSTU3 Polyclonal Antibody

Sign In for Pricing
View Details
STUB1 Human shRNA Plasmid Kit (Locus ID 10273)
TL316909 1 Kit

STUB1 Human shRNA Plasmid Kit (Locus ID 10273)

Sign In for Pricing
View Details
Recombinant Human DGKH Protein, N-His
AP92536 50 µg

Recombinant Human DGKH Protein, N-His

Sign In for Pricing
View Details
Shkbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
43723114 3x 1.0 µg

Shkbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PIAS3 Human Over-expression Lysate
orb1357414 100 µg

PIAS3 Human Over-expression Lysate

Sign In for Pricing
View Details
Canine 17 Hydroxyprogesterone ELISA kit
GTR10379767 96 Well

Canine 17 Hydroxyprogesterone ELISA kit

Sign In for Pricing
View Details