Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

Product Specifications

Product Name Alternative

MHC class I NK cell receptor Natural killer-associated transcript 7 NKAT7

Abbreviation

Recombinant Human KIR2DS3 protein, partial

Gene Name

KIR2DS3

UniProt

Q14952

Expression Region

22-245aa

Organism

Homo sapiens (Human)

Target Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Molecular Weight

26.7 kDa

References & Citations

"Assessment of killer cell immunoglobulinlike receptor expression and corresponding HLA class I phenotypes demonstrates heterogenous KIR expression independent of anticipated HLA class I ligands." Becker S., Tonn T., Fussel T., Uhrberg M., Bogdanow M., Seifried E., Seidl C. Hum. Immunol. 64:183-193 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crabp2 Mouse Gene Knockout Kit (CRISPR)
KN503795 1 Kit

Crabp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Rat IgG2b, λ Isotype Control[G013B8]
AN00565C-01 20 Tests

FITC Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details
FITC Rat IgG2b, λ Isotype Control[G013B8]
AN00565C-02 100 Tests

FITC Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details
FITC Rat IgG2b, λ Isotype Control[G013B8]
AN00565C-03 2x 100 Tests

FITC Rat IgG2b, λ Isotype Control[G013B8]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: right middle lobe
CS712258 5x 5 µm

Tissue FFPE Sections, Lung: right middle lobe

Sign In for Pricing
View Details
AKT1 Rabbit Monoclonal Antibody [Clone ID: 23GB1695]
TA424491S 20 µL

AKT1 Rabbit Monoclonal Antibody [Clone ID: 23GB1695]

Sign In for Pricing
View Details