Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-synuclein (Sncb)

Product Specifications

Product Name Alternative

Sncb; Beta-synuclein

Abbreviation

Recombinant Mouse Sncb protein

Gene Name

Sncb

UniProt

Q91ZZ3

Expression Region

1-133aa

Organism

Mus musculus (Mouse)

Target Sequence

MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

May be involved in neuronal plasticity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in neuronal plasticity.

Molecular Weight

14.1 kDa

References & Citations

"Genomic organization, chromosome location, and expression analysis of mouse beta-synuclein, a candidate for involvement in neurodegeneration." Sopher B.L., Koszdin K.L., McClain M.E., Myrick S.B., Martinez R.A., Smith A.C., La Spada A.R. Cytogenet. Cell Genet. 93:117-123 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139)
MBS7036914-01 0.02 mg

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139)
MBS7036914-02 0.1 mg

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139)
MBS7036914-03 5x 0.1 mg

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139)

Sign In for Pricing
View Details
Lentiviral human C1orf159 shRNA (UAS) - Lentiviral human C1orf159 shRNA (UAS, GFP) (100)
GTR15343620 1 Vial

Lentiviral human C1orf159 shRNA (UAS) - Lentiviral human C1orf159 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Simian immunodeficiency virus agm.vervet Protein Tat (tat)
MBS1191980-01 0.05 mg (E-Coli)

Recombinant Simian immunodeficiency virus agm.vervet Protein Tat (tat)

Sign In for Pricing
View Details
Recombinant Simian immunodeficiency virus agm.vervet Protein Tat (tat)
MBS1191980-02 0.05 mg (Yeast)

Recombinant Simian immunodeficiency virus agm.vervet Protein Tat (tat)

Sign In for Pricing
View Details