Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Translational regulator CsrA (csrA)

Product Specifications

Product Name Alternative

CsrA; ECDH10B_2864; Translational regulator CsrA; Carbon storage regulator

Abbreviation

Recombinant E.coli csrA protein

Gene Name

CsrA

UniProt

B1XCM4

Expression Region

1-61aa

Organism

Escherichia coli (strain K12 / DH10B)

Target Sequence

MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Affects glycogen biosynthesis, gluconeogenesis, cell size and surface properties. Regulates glycogen synthesis under both aerobic and anaerobic conditions. Seems to accelerate the degradation of glg gene transcripts, potentially through selective RNA binding. Acts to inhibit interaction between the LetD protein and the A subunit of DNA gyrase. Also required for motility and flagellum biosynthesis through the post-transcriptional activation of flhDC expression. This involves binding to and stabilization of the flhDC message by CsrA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA (s) .

Molecular Weight

10.9 kDa

References & Citations

"The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." Durfee T., Nelson R., Baldwin S., Plunkett G. III, Burland V., Mau B., Petrosino J.F., Qin X., Muzny D.M., Ayele M., Gibbs R.A., Csorgo B., Posfai G., Weinstock G.M., Blattner F.R. J. Bacteriol. 190:2597-2606 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ITGA1 Antibody, HRP conjugated
MBS7104942-01 0.05 mg

ITGA1 Antibody, HRP conjugated

Ask
View Details
ITGA1 Antibody, HRP conjugated
MBS7104942-02 0.1 mg

ITGA1 Antibody, HRP conjugated

Ask
View Details
ITGA1 Antibody, HRP conjugated
MBS7104942-03 5x 0.1 mg

ITGA1 Antibody, HRP conjugated

Ask
View Details
Vorsetuzumab Biosimilar - Research Grade
ICH5992-10mg 10 mg

Vorsetuzumab Biosimilar - Research Grade

Ask
View Details
ZNF364 Rabbit Monoclonal Antibody
E10G20828 100 μl

ZNF364 Rabbit Monoclonal Antibody

Ask
View Details
PAR-3 amide Peptide
abx265394-01 5 mg

PAR-3 amide Peptide

Ask
View Details