Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear receptor subfamily 4 group A member 2 (NR4A2)

Product Specifications

Product Name Alternative

Immediate-early response protein NOT Orphan nuclear receptor NURR1 Transcriptionally-inducible nuclear receptor NOT, NURR1, TINUR

Abbreviation

Recombinant Human NR4A2 protein

Gene Name

NR4A2

UniProt

P43354

Expression Region

1-598aa

Organism

Homo sapiens (Human)

Target Sequence

MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons (By similarity) .

Molecular Weight

68.6 kDa

References & Citations

"NOT, a human immediate-early response gene closely related to the steroid/thyroid hormone receptor NAK1/TR3." Mages H.W., Rilke O., Bravo R., Senger G., Kroczek R.A. Mol. Endocrinol. 8:1583-1591 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)
MBS1480861-01 0.02 mg (E-Coli)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)
MBS1480861-02 0.1 mg (E-Coli)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)
MBS1480861-03 0.02 mg (Yeast)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)
MBS1480861-04 0.1 mg (Yeast)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)
MBS1480861-05 0.02 mg (Baculovirus)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)

Ask
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)
MBS1480861-06 1 mg (E-Coli)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Carbon storage regulator homolog (csrA)

Ask
View Details