Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse fMet-Leu-Phe receptor (Fpr1), partial

Product Specifications

Product Name Alternative

N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor

Abbreviation

Recombinant Mouse Fpr1 protein, partial

Gene Name

Fpr1

UniProt

P33766

Expression Region

1-35aa

Organism

Mus musculus (Mouse)

Target Sequence

MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Molecular Weight

33.7 kDa

References & Citations

"Species and subtype variants of the N-formyl peptide chemotactic receptor reveal multiple important functional domains." Gao J.-L., Murphy P.M. J. Biol. Chem. 268:25395-25401 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF647 conjugate, 0.1mg/mL
BNC471975-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF488A conjugate, 0.1mg/mL
BNC881365-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF594 conjugate, 0.1mg/mL
BNC940887-500 1x 500 µL

Cytochrome C (CTC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details