Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31

Product Specifications

Product Name Alternative

Short name: Alpha-BTX A31 Short name: Alpha-Bgt (A31) Short name: BGTX A31 Alternative name (s) : Long neurotoxin 1

Abbreviation

Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31 protein

UniProt

P60615

Expression Region

22-95aa

Organism

Bungarus multicinctus (Many-banded krait)

Target Sequence

IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 µM) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM) .

Molecular Weight

38 kDa

References & Citations

"Genetic organization of alpha-bungarotoxins from Bungarus multicinctus (Taiwan banded krait) : evidence showing that the production of alpha-bungarotoxin isotoxins is not derived from edited mRNAs." Chang L.-S., Lin S.-K., Huang H.-B., Hsiao M. Nucleic Acids Res. 27:3970-3975 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Geranylgeranyl transferase type-2 subunit α (RABGGTA) Porcine ELISA Kit
D6742 96 Tests

Geranylgeranyl transferase type-2 subunit α (RABGGTA) Porcine ELISA Kit

Ask
View Details
Mouse Fc gamma RIII / CD16 Protein, His Tag (SPR & BLI & MALS verified)
CDA-M52H8-100ug 100 µg

Mouse Fc gamma RIII / CD16 Protein, His Tag (SPR & BLI & MALS verified)

Ask
View Details
Escherichia coli Enteroagregativa (EAEC) PCR kit
PCR-H679-96D 100T

Escherichia coli Enteroagregativa (EAEC) PCR kit

Ask
View Details
Human Activating Transcription Factor 4 (ATF4) Elisa Kit
EK710580 96 Well

Human Activating Transcription Factor 4 (ATF4) Elisa Kit

Ask
View Details
EIF5AL1 Human shRNA Lentiviral Particle (Locus ID 143244)
TL321061V 500 µL Each

EIF5AL1 Human shRNA Lentiviral Particle (Locus ID 143244)

Ask
View Details
Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody
abx145012-01 100 µg

Tumor Necrosis Factor Ligand Superfamily Member 10 (TNFSF10) Antibody

Ask
View Details