Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombopoietin (THPO), partial

Product Specifications

Product Name Alternative

C-mpl ligand Short name: ML Megakaryocyte colony-stimulating factor Megakaryocyte growth and development factor Short name: MGDF Myeloproliferative leukemia virus oncogene ligand

Abbreviation

Recombinant Human THPO protein, partial

Gene Name

THPO

UniProt

P40225

Expression Region

22-195aa

Organism

Homo sapiens (Human)

Target Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Molecular Weight

34.7 kDa

References & Citations

"Stimulation of megakaryocytopoiesis and thrombopoiesis by the c-Mpl ligand." de Sauvage F.J., Hass P.E., Spencer S.D., Malloy B.E., Gurney A.L., Spencer S.A., Darbonne W.C., Henzel W.J., Wong S.C., Kuang W.-J., Oles K.J., Hultgren B., Solberg L.A. Jr., Goeddel D.V., Eaton D.L. Nature 369:533-538 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51I1 Antibody
8G449-AAT 50 µg

OR51I1 Antibody

Sign In for Pricing
View Details
(1R,2R)-Ticagrelor Impurity
TRC-T399150-25MG 25 mg

(1R,2R)-Ticagrelor Impurity

Sign In for Pricing
View Details
Sodium DL-Lactate-d3 (60% w/w in H2O)
TRC-S644002-10MG 10 mg

Sodium DL-Lactate-d3 (60% w/w in H2O)

Sign In for Pricing
View Details
Human ZNF705D activation kit by CRISPRa
GA118981 1 Kit

Human ZNF705D activation kit by CRISPRa

Sign In for Pricing
View Details
HSP105 Antibody
8C0231-AAT 50 µg

HSP105 Antibody

Sign In for Pricing
View Details
Spastin (Sp 6C6), CF647 conjugate, 0.1mg/mL
BNC473070-100 1x 100 µL

Spastin (Sp 6C6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details