Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1)

Product Specifications

Product Name Alternative

4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha Short name: DCoH Short name: Dimerization cofactor of HNF1 Phenylalanine hydroxylase-stimulating protein Pterin carbinolamine dehydratase DCOH, PCBD

Abbreviation

Recombinant Human PCBD1 protein

Gene Name

PCBD1

UniProt

P61457

Expression Region

2-104aa

Organism

Homo sapiens (Human)

Target Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.

Molecular Weight

15.9 kDa

References & Citations

"Phenylalanine hydroxylase-stimulating protein/pterin-4 alpha-carbinolamine dehydratase from rat and human liver. Purification, characterization, and complete amino acid sequence." Hauer C.R., Rebrin I., Thoeny B., Neuheiser F., Curtius H.-C., Hunziker P., Blau N., Ghisla S., Heizmann C.W. J. Biol. Chem. 268:4828-4831 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DAB2 AAV siRNA Pooled Vector
17634161 1.0 μg

DAB2 AAV siRNA Pooled Vector

Ask
View Details
human anti-human vWF mAb(8T9)
E4A09G13-8T9 100ug

human anti-human vWF mAb(8T9)

Ask
View Details
Anti-Elastin Microfibril Interface Located Protein 1 (EMILIN1) Monoclonal antibody
FY-AB35264-01 1 mL

Anti-Elastin Microfibril Interface Located Protein 1 (EMILIN1) Monoclonal antibody

Ask
View Details
Anti-Elastin Microfibril Interface Located Protein 1 (EMILIN1) Monoclonal antibody
FY-AB35264-02 100 µL

Anti-Elastin Microfibril Interface Located Protein 1 (EMILIN1) Monoclonal antibody

Ask
View Details
Anti-Elastin Microfibril Interface Located Protein 1 (EMILIN1) Monoclonal antibody
FY-AB35264-03 200 µL

Anti-Elastin Microfibril Interface Located Protein 1 (EMILIN1) Monoclonal antibody

Ask
View Details
Mouse Monoclonal beta-2 Adrenergic R/ADRB2 Antibody (586107) [mFluor Violet 450 SE]
FAB100401MFV450 0.1 mL

Mouse Monoclonal beta-2 Adrenergic R/ADRB2 Antibody (586107) [mFluor Violet 450 SE]

Ask
View Details