Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sepiapterin reductase (SPR)

Product Specifications

Product Name Alternative

OTTHUMP00000160199; SDR38C1; Sepiapterin reductase (7,8 dihydrobiopterin:NADP+ oxidoreductase) ; Sepiapterin reductase; Short chain dehydrogenase/reductase family 38C, member 1; SPR; SPRE_HUMAN

Abbreviation

Recombinant Human SPR protein

Gene Name

SPR

UniProt

P35270

Expression Region

1-261aa

Organism

Homo sapiens (Human)

Target Sequence

MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.

Molecular Weight

32 kDa

References & Citations

"Detection of a novel sepiapterin reductase mRNA: assay of mRNA in various cells and tissues of various species." Maier J., Schott K., Werner T., Bacher A., Ziegler I. Exp. Cell Res. 204:217-222 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (1-Benzylpiperidin-4-ylidene) -2-phenylacetonitrile
GAA51769-01 50 mg

2- (1-Benzylpiperidin-4-ylidene) -2-phenylacetonitrile

Sign In for Pricing
View Details
2- (1-Benzylpiperidin-4-ylidene) -2-phenylacetonitrile
GAA51769-02 0.5 g

2- (1-Benzylpiperidin-4-ylidene) -2-phenylacetonitrile

Sign In for Pricing
View Details
PCDHGA6 ORF Vector (Human) (pORF)
36170011 1.0 µg DNA

PCDHGA6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GNB2 Recombinant Antibody, PerCP Conjugated
bsm-62044R-PerCP-01 20 µL

GNB2 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
GNB2 Recombinant Antibody, PerCP Conjugated
bsm-62044R-PerCP-02 100 µL

GNB2 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
ABI2 Rabbit Polyclonal Antibody (Cy3)
orb989696 100 µL

ABI2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details