Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1), partial

Product Specifications

Product Name Alternative

Secreted LY6/PLAUR domain-containing protein 2 Secreted Ly-6/uPAR-related protein 2

Abbreviation

Recombinant Human LYNX1 protein, partial

Gene Name

LYNX1

UniProt

P0DP58

Expression Region

57-131aa of P0DP58-2

Organism

Homo sapiens (Human)

Target Sequence

IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3

Molecular Weight

10 kDa

References & Citations

"SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris." Tsuji H., Okamoto K., Matsuzaka Y., Iizuka H., Tamiya G., Inoko H. Genomics 81:26-33 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) ACPS Polyclonal Antibody
MBS7178842 Inquire

Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) ACPS Polyclonal Antibody

Ask
View Details
Chicken Low Density Lipoprotein Receptor Related Protein 1 (LRP1) ELISA Kit-Sandwich
EK1F364-01 48 Test

Chicken Low Density Lipoprotein Receptor Related Protein 1 (LRP1) ELISA Kit-Sandwich

Ask
View Details
Chicken Low Density Lipoprotein Receptor Related Protein 1 (LRP1) ELISA Kit-Sandwich
EK1F364-02 96 Tests

Chicken Low Density Lipoprotein Receptor Related Protein 1 (LRP1) ELISA Kit-Sandwich

Ask
View Details
Human sCD163 (Soluable Cluster of Differentiation 163) ELISA Kit
E-EL-H0036-01 24 Tests

Human sCD163 (Soluable Cluster of Differentiation 163) ELISA Kit

Ask
View Details
Human sCD163 (Soluable Cluster of Differentiation 163) ELISA Kit
E-EL-H0036-02 48 Tests

Human sCD163 (Soluable Cluster of Differentiation 163) ELISA Kit

Ask
View Details
Human sCD163 (Soluable Cluster of Differentiation 163) ELISA Kit
E-EL-H0036-03 96 Tests

Human sCD163 (Soluable Cluster of Differentiation 163) ELISA Kit

Ask
View Details