Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metallothionein-4 (MT4)

Product Specifications

Product Name Alternative

Metallothionein-IV

Abbreviation

Recombinant Human MT4 protein

Gene Name

MT4

UniProt

P47944

Expression Region

1-62aa

Organism

Homo sapiens (Human)

Target Sequence

MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.

Molecular Weight

22.5 kDa

References & Citations

"Induction of a new metallothionein isoform (MT-IV) occurs during differentiation of stratified squamous epithelia." Quaife C.J., Findley S.D., Erickson J.C., Froelick G.J., Kelly E.J., Zambrowicz B.P., Palmiter R.D. Biochemistry 33:7250-7259 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB5C (NM_201434) Human Recombinant Protein
TP310698L 1 mg

RAB5C (NM_201434) Human Recombinant Protein

Sign In for Pricing
View Details
Triphenylphosphine Oxide-d15
TRC-T808982-10MG 10 mg

Triphenylphosphine Oxide-d15

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF647 conjugate, 0.1mg/mL
BNC472427-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (ECM1/792), CF594 conjugate, 0.1mg/mL
BNC940792-500 1x 500 µL

IgA Secretory Component (ECM1/792), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ACSF3 activation kit by CRISPRa
GA116299 1 Kit

Human ACSF3 activation kit by CRISPRa

Sign In for Pricing
View Details
Fmoc-Trp (Boc) Wang Resin LL
HLL0751501328.25G 25 g

Fmoc-Trp (Boc) Wang Resin LL

Sign In for Pricing
View Details