Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-1 (PRDX1)

Product Specifications

Product Name Alternative

Natural killer cell-enhancing factor A Proliferation-associated gene protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2

Abbreviation

Recombinant Human PRDX1 protein

Gene Name

PRDX1

UniProt

Q06830

Expression Region

1-199aa

Organism

Homo sapiens (Human)

Target Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H (2) O (2)

Molecular Weight

24.1 kDa

References & Citations

"Mammalian peroxiredoxin isoforms can reduce hydrogen peroxide generated in response to growth factors and tumor necrosis factor-alpha." Kang S.W., Chae H.Z., Seo M.S., Kim K., Baines I.C., Rhee S.G. J. Biol. Chem. 273:6297-6302 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (CCNB1) Mouse Monoclonal Antibody [Clone ID: 5G6]
AM06538SU-N 100 µL

Cyclin B1 (CCNB1) Mouse Monoclonal Antibody [Clone ID: 5G6]

Sign In for Pricing
View Details
PIK3IP1 (NM_001135911) Human Over-expression Lysate
LY427727 100 µg

PIK3IP1 (NM_001135911) Human Over-expression Lysate

Sign In for Pricing
View Details
7-(2-Hydroxy-3-(isopropylamino)propoxy)-2,3-dihydro-1H-inden-1-one
TRC-H853920-5MG 5 mg

7-(2-Hydroxy-3-(isopropylamino)propoxy)-2,3-dihydro-1H-inden-1-one

Sign In for Pricing
View Details
Profilin 1 (PFN1) Human Gene Knockout Kit (CRISPR)
KN402338 1 Kit

Profilin 1 (PFN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DACT2 activation kit by CRISPRa
GA116164 1 Kit

Human DACT2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Osteopontin (OPN) ELISA Kit
RD-OPN-Mu-01 96 Tests

Mouse Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details