Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Pregnancy-associated protein bPAP

Product Specifications

Product Name Alternative

Pregnancy-associated protein bPAP; Fragments

Abbreviation

Recombinant Bovine Pregnancy-associated protein bPAP

UniProt

P84291

Expression Region

1-100aa

Organism

Bos taurus (Bovine)

Target Sequence

DSELAGPRGARGPHGLSGPHGLSGLSGPSGYTGPIGMSGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

References & Citations

"Characterization of a bovine pregnancy-associated protein using two-dimensional gel electrophoresis, N-terminal sequencing and mass spectrometry." Pyo J., Hwang S.-I., Oh J., Lee S.-J., Kang S.-C., Kim J.-S., Lim J. Proteomics 3:2420-2427 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT3A1 (NM_152404) Human Recombinant Protein
TP309702L 1 mg

UGT3A1 (NM_152404) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant HIV-1 p24 protein (group N, strain 06CM-U14296) (His Tag)
PKSV030195 100 µg

Recombinant HIV-1 p24 protein (group N, strain 06CM-U14296) (His Tag)

Sign In for Pricing
View Details
Human CMKLR2 activation kit by CRISPRa
GA101890 1 Kit

Human CMKLR2 activation kit by CRISPRa

Sign In for Pricing
View Details
RCCD1 (NM_001017919) Human Over-expression Lysate
LY422749 100 µg

RCCD1 (NM_001017919) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha smooth muscle Actin Recombinant Chimeric Antibody Antibody
HA610362 100 µL

Alpha smooth muscle Actin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
SFRS2B Antibody
8C18938-AAT 50 µg

SFRS2B Antibody

Sign In for Pricing
View Details