Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Pregnancy-associated protein bPAP

Product Specifications

Product Name Alternative

Pregnancy-associated protein bPAP; Fragments

Abbreviation

Recombinant Bovine Pregnancy-associated protein bPAP

UniProt

P84291

Expression Region

1-100aa

Organism

Bos taurus (Bovine)

Target Sequence

DSELAGPRGARGPHGLSGPHGLSGLSGPSGYTGPIGMSGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

References & Citations

"Characterization of a bovine pregnancy-associated protein using two-dimensional gel electrophoresis, N-terminal sequencing and mass spectrometry." Pyo J., Hwang S.-I., Oh J., Lee S.-J., Kang S.-C., Kim J.-S., Lim J. Proteomics 3:2420-2427 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), 0.2mg/mL
BNUB3339-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), 0.2mg/mL

Sign In for Pricing
View Details
C6ORF199 (AK9) Rabbit Polyclonal Antibody
TA366266 100 µL

C6ORF199 (AK9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM186A Antibody
KC-3103-01 50 μL

FAM186A Antibody

Sign In for Pricing
View Details
FAM186A Antibody
KC-3103-02 100 µL

FAM186A Antibody

Sign In for Pricing
View Details
FAM186A Antibody
KC-3103-03 1 mL

FAM186A Antibody

Sign In for Pricing
View Details
MVD (N-term) Rabbit Polyclonal Antibody
AP17571PU-N 400 µL

MVD (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details