Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium tetani Tetanus toxin (tetX), partial

Product Specifications

Product Name Alternative

Tentoxylysin

Abbreviation

Recombinant Clostridium tetani tetX protein, partial

Gene Name

TetX

UniProt

P04958

Expression Region

2-457aa

Organism

Clostridium tetani (strain Massachusetts / E88)

Target Sequence

PITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTA

Tag

N-terminal 6xHis-B2M-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln-|-Phe-77' bond of synaptobrevin-2.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln-|-Phe-77' bond of synaptobrevin-2.

Molecular Weight

66.3 kDa

References & Citations

"Tetanus toxin: primary structure, expression in E. coli, and homology with botulinum toxins." Eisel U., Jarausch W., Goretzki K., Henschen A., Engels J., Weller U., Hudel M., Habermann E., Niemann H. EMBO J. 5:2495-2502 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PARN Antibody
NBP1-84303 0.1 mL

Rabbit Polyclonal PARN Antibody

Sign In for Pricing
View Details
Smarce1 AAV siRNA Pooled Vector
44419164 1.0 µg

Smarce1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MYBL1 Antibody
A24584-50UG 50 µg

MYBL1 Antibody

Sign In for Pricing
View Details
Lsp1 (BC003796) Mouse Tagged ORF Clone Lentiviral Particle
MR204663L3V 200 µL

Lsp1 (BC003796) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FAR1 Polyclonal Antibody, Cy5.5 Conjugated
bs-9437R-Cy5.5 100 µL

FAR1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Ataxin-2 Antibody (01) [Alexa Fluor 405]
NBP3-26903AF405 0.1 mL

Mouse Monoclonal Ataxin-2 Antibody (01) [Alexa Fluor 405]

Sign In for Pricing
View Details