Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vesicle-associated membrane protein 2 (Vamp2), partial

Product Specifications

Product Name Alternative

Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2

Abbreviation

Recombinant Rat Vamp2 protein, partial

Gene Name

Vamp2

UniProt

P63045

Expression Region

2-94aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity) . Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1

Molecular Weight

14.1 kDa

References & Citations

"Two vesicle-associated membrane protein genes are differentially expressed in the rat central nervous system." Elferink L.A., Trimble W.S., Scheller R.H. J. Biol. Chem. 264:11061-11064 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFML2A Antibody
ABD5039 100 µg

OLFML2A Antibody

Sign In for Pricing
View Details
Human DMD (Dystrophin) ELISA Kit
EKE60861-01 96 Tests

Human DMD (Dystrophin) ELISA Kit

Sign In for Pricing
View Details
Human DMD (Dystrophin) ELISA Kit
EKE60861-02 5x 96 Tests

Human DMD (Dystrophin) ELISA Kit

Sign In for Pricing
View Details
Pitrm1 (NM_001107363) Rat Untagged Clone
RN203141 10 µg

Pitrm1 (NM_001107363) Rat Untagged Clone

Sign In for Pricing
View Details
Anti-GABA A Receptor alpha 3  (3C6)
YF-MA13170 100 ug

Anti-GABA A Receptor alpha 3 (3C6)

Sign In for Pricing
View Details
PHC2 (NM_004427) Human Over-expression Lysate
E45H07205-2 20 µg

PHC2 (NM_004427) Human Over-expression Lysate

Sign In for Pricing
View Details