Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 (IL3) (Active)

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic growth factor; Mast cell growth factor (MCGF) ; Multipotential colony-stimulating factor; P-cell-stimulating factor; IL3

Abbreviation

Recombinant Human IL3 protein (Active)

Gene Name

IL3

UniProt

P08700

Expression Region

20-152aa

Organism

Homo sapiens (Human)

Target Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Tag

C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Stimulates also mature basophils, eosinophils, and monocytes to become functionally activated. In addition, plays an important role in neural cell proliferation and survival.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 5.972-17.16 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.0 kDa

References & Citations

Distinct Assemblies of Heterodimeric Cytokine Receptors Govern Stemness Programs in Leukemia. Kan W.L., Dhagat U., Kaufmann K.B., Hercus T.R., Nero T.L., Zeng A.G.X., Toubia J., Barry E.F., Broughton S.E., Lopez A.F. Cancer Discov 13:1922-1947 (2023)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgp9.5 (UCHL-1) (13C4), Biotin conjugate, 0.1mg/mL
BNCB0147-500 1x 500 µL

Pgp9.5 (UCHL-1) (13C4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse SDCBP protein (C-6His)
CD00240-01 10 µg

Recombinant Mouse SDCBP protein (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse SDCBP protein (C-6His)
CD00240-02 50 µg

Recombinant Mouse SDCBP protein (C-6His)

Sign In for Pricing
View Details
Itgam Antibody (Biotin)
orb1251351 0.5 mg

Itgam Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal BRCC3 Antibody (3B1) [Janelia Fluor 646]
NBP1-30429JF646 0.1 mL

Mouse Monoclonal BRCC3 Antibody (3B1) [Janelia Fluor 646]

Sign In for Pricing
View Details
RALGPS1 Protein Lysate (Human) with C-Ha Tag
38465031 100 µg

RALGPS1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details