Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2)

Product Specifications

Product Name Alternative

Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen: Par j 2.0101

Abbreviation

Recombinant Parietaria judaica LTP2 protein

Gene Name

LTP2

UniProt

P55958

Expression Region

32-133aa

Organism

Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa)

Target Sequence

EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Molecular Weight

27.3 kDa

References & Citations

"Assignment of disulphide bridges in Par j 2.0101, a major allergen of Parietaria judaica pollen." Amoresano A., Pucci P., Duro G., Colombo P., Costa M.A., Izzo V., Lamba D., Geraci D. Biol. Chem. 384:1165-1172 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Hif1a Pre-designed siRNA Set A
SI206240A 1 Each

Rat Hif1a Pre-designed siRNA Set A

Sign In for Pricing
View Details
C7orf43 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0255105 3x 1.0 µg

C7orf43 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human ACTg2 ELISA Kit
E000404 1 Each

Human ACTg2 ELISA Kit

Sign In for Pricing
View Details
Gvin1 sgRNA CRISPR Lentivector set (Mouse)
K3763001 3x 1.0 µg

Gvin1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Anti-TRPV6 antibody
SL15506R-01 50 µL

Rabbit Anti-TRPV6 antibody

Sign In for Pricing
View Details
Rabbit Anti-TRPV6 antibody
SL15506R-02 100 µL

Rabbit Anti-TRPV6 antibody

Sign In for Pricing
View Details