Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphotoxin-alpha (Lta)

Product Specifications

Product Name Alternative

TNF-beta Tumor necrosis factor ligand superfamily member 1 Tnfb, Tnfsf1

Abbreviation

Recombinant Mouse Lta protein

Gene Name

Lta

UniProt

P09225

Expression Region

34-202aa

Organism

Mus musculus (Mouse)

Target Sequence

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.

Molecular Weight

23.6 kDa

References & Citations

"The genes for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) are tandemly arranged on chromosome 17 of the mouse." Nedospasov S.A., Hirt B., Shakhov A.N., Dobrynin V.N., Kawashima E., Accolla R.S., Jongeneel C.V. Nucleic Acids Res. 14:7713-7725 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAJ48 ORF Vector (Human) (pORF)
ORF034259 1.0 µg DNA

TRAJ48 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human EZH2, N-GST
MBS1574774-01 0.1 mg

Recombinant Human EZH2, N-GST

Sign In for Pricing
View Details
Recombinant Human EZH2, N-GST
MBS1574774-02 1 mg

Recombinant Human EZH2, N-GST

Sign In for Pricing
View Details
Recombinant Human EZH2, N-GST
MBS1574774-03 5x 1 mg

Recombinant Human EZH2, N-GST

Sign In for Pricing
View Details
HAUS5, NT (HAUS5, KIAA0841, HAUS augmin-like complex subunit 5) (MaxLight 550) discontinued
036437-ML550 100 µL

HAUS5, NT (HAUS5, KIAA0841, HAUS augmin-like complex subunit 5) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Human IL-22 Protein
MBS8305032-01 0.01 mg

Recombinant Human IL-22 Protein

Sign In for Pricing
View Details