Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum C phage Main hemagglutinin component type C (HA-33)

Product Specifications

Product Name Alternative

HA 33 kDa subunit HA1

Abbreviation

Recombinant Clostridium botulinum HA-33 protein

Gene Name

HA-33

UniProt

P0DPR0

Expression Region

2-286aa

Organism

Clostridium botulinum

Target Sequence

SQTNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYISRNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Protects the structural integrity of the neurotoxin; may increase internalization of the neurotoxin into the bloodstream of the host. Involved in binding to the small intestine through interactions with glycolipids and glycoproteins containing sialic acid moieties.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Protects the structural integrity of the neurotoxin; may increase internalization of the neurotoxin into the bloodstream of the host. Involved in binding to the small intestine through interactions with glycolipids and glycoproteins containing sialic acid moieties.

Molecular Weight

53.6 kDa

References & Citations

"Botulinal neurotoxin C1 complex genes, clostridial neurotoxin homology and genetic transfer in Clostridium botulinum." Hauser D., Gibert M., Marvaud J.C., Eklund M.W., Popoff M.R. Toxicon 33:515-526 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFOD1 (NM_018988) Human Over-expression Lysate
LY402719 100 µg

GFOD1 (NM_018988) Human Over-expression Lysate

Sign In for Pricing
View Details
MSX2 (Center) Rabbit Polyclonal Antibody
AP52762PU-N 400 µL

MSX2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SAG Antibody
OC-467-01 50 μL

SAG Antibody

Sign In for Pricing
View Details
SAG Antibody
OC-467-02 100 µL

SAG Antibody

Sign In for Pricing
View Details
SAG Antibody
OC-467-03 1 mL

SAG Antibody

Sign In for Pricing
View Details
IFNGR2 (C-term) Rabbit Polyclonal Antibody
AP17492PU-N 400 µL

IFNGR2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details