Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte-specific transcript 1 protein (LST1)

Product Specifications

Product Name Alternative

Protein B144

Abbreviation

Recombinant Human LST1 protein

Gene Name

LST1

UniProt

O00453

Expression Region

1-66aa

Organism

Homo sapiens (Human)

Target Sequence

MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Molecular Weight

11.5 kDa

References & Citations

"Complex expression pattern of the TNF region gene LST1 through differential regulation, initiation, and alternative splicing." de Baey A., Fellerhoff B., Maier S., Martinozzi S., Weidle U., Weiss E.H. Genomics 45:591-600 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 10

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Anti-Rabbit IgG (H+L), Mouse/Rat/Human SP ads-CY5
6440-15 1 mg

Donkey Anti-Rabbit IgG (H+L), Mouse/Rat/Human SP ads-CY5

Sign In for Pricing
View Details
Lactoferrin (LTF) Human ELISA Kit
E5819 96 Tests

Lactoferrin (LTF) Human ELISA Kit

Sign In for Pricing
View Details
H-Nle-2-CT Polystyrene Resin
H0751503319.25G 25 g

H-Nle-2-CT Polystyrene Resin

Sign In for Pricing
View Details
Recombinant Human VASN Protein
CRP2511-01 10 µg

Recombinant Human VASN Protein

Sign In for Pricing
View Details
Recombinant Human VASN Protein
CRP2511-02 50 µg

Recombinant Human VASN Protein

Sign In for Pricing
View Details
Recombinant Human VASN Protein
CRP2511-03 500 µg

Recombinant Human VASN Protein

Sign In for Pricing
View Details