Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Outer capsid glycoprotein VP7

Product Specifications

Product Name Alternative

; Outer capsid glycoprotein VP7; Fragment

Abbreviation

Recombinant Rotavirus A Outer capsid glycoprotein VP7 protein

UniProt

A8D8S8

Expression Region

34-309aa

Organism

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A)

Target Sequence

QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Outer capsid protein involved in attachment and possibly entry into the host epithelial cell. It is subsequently lost, together with VP4, following virus entry into the host cell. The outer layer contains 780 copies of VP7, grouped as 260 trimers. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved (By similarity) .

Molecular Weight

33 kDa

References & Citations

"Nucleotide sequence of the structural glycoprotein VP7 gene of C486 G6P[5] Bovine rotavirus." Gonzalez D.D., Mozgovoj M.V., Bellido D., Parreno V.G., Wigdorovitz A., Dus Santos M.J. Submitted (SEP-2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal p27/Kip1 Antibody (SPM348) - IHC-Prediluted
NBP2-44494 7 mL

Mouse Monoclonal p27/Kip1 Antibody (SPM348) - IHC-Prediluted

Ask
View Details
16-Phenyl tetranor Prostaglandin F2?
MF-0054417-01 10 mg

16-Phenyl tetranor Prostaglandin F2?

Ask
View Details
16-Phenyl tetranor Prostaglandin F2?
MF-0054417-02 50 mg

16-Phenyl tetranor Prostaglandin F2?

Ask
View Details
HSD17B13 Blocking Peptide
MBS9632815-01 1 mg

HSD17B13 Blocking Peptide

Ask
View Details
HSD17B13 Blocking Peptide
MBS9632815-02 5x 1 mg

HSD17B13 Blocking Peptide

Ask
View Details
Bovine Epidermal Growth Factor Receptor Kinase Substrate 8-Like Protein 1 (EPS8L1) ELISA Kit
OM619004 96 Strip Well

Bovine Epidermal Growth Factor Receptor Kinase Substrate 8-Like Protein 1 (EPS8L1) ELISA Kit

Ask
View Details