Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Replication factor C subunit 1 (RFC1), partial

Product Specifications

Product Name Alternative

Activator 1 140 kDa subunit

Abbreviation

Recombinant Human RFC1 protein, partial

Gene Name

RFC1

UniProt

P35251

Expression Region

402-492aa

Organism

Homo sapiens (Human)

Target Sequence

GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA.

Molecular Weight

11.8 kDa

References & Citations

"The human DNA-binding protein, PO-GA, is homologous to the large subunit of mouse replication factor C: regulation by alternate 3' processing of mRNA." Lu Y., Riegel A.T. Gene 145:261-265 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indirubin (NSC 105327)
C08516-5mg 5 mg

Indirubin (NSC 105327)

Sign In for Pricing
View Details
Lentiviral human APOOL shRNA (UAS) - Lentiviral human APOOL shRNA (UAS, GFP) plasmid
GTR15097258 1 Vial

Lentiviral human APOOL shRNA (UAS) - Lentiviral human APOOL shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
mmu-miR-5627-3p miRNA Inhibitor
MBS8296501-01 10 nmol

mmu-miR-5627-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-5627-3p miRNA Inhibitor
MBS8296501-02 20 nmol

mmu-miR-5627-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-5627-3p miRNA Inhibitor
MBS8296501-03 5x 20 nmol

mmu-miR-5627-3p miRNA Inhibitor

Sign In for Pricing
View Details
2-Cyano-3-ethylvaleric Acid Ethyl Ester
417258 250 mg

2-Cyano-3-ethylvaleric Acid Ethyl Ester

Sign In for Pricing
View Details