Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1)

Product Specifications

Product Name Alternative

4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha

Abbreviation

Recombinant Human PCBD1 protein

Gene Name

PCBD1

UniProt

P61457

Expression Region

2-104aa

Organism

Homo sapiens (Human)

Target Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.

Molecular Weight

41.9 kDa

References & Citations

"Phenylalanine hydroxylase-stimulating protein/pterin-4 alpha-carbinolamine dehydratase from rat and human liver. Purification, characterization, and complete amino acid sequence." Hauer C.R., Rebrin I., Thoeny B., Neuheiser F., Curtius H.-C., Hunziker P., Blau N., Ghisla S., Heizmann C.W. J. Biol. Chem. 268:4828-4831 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Component 1R (C1r) (MaxLight 405)
MBS6445793-01 0.1 mL

Complement Component 1R (C1r) (MaxLight 405)

Sign In for Pricing
View Details
Complement Component 1R (C1r) (MaxLight 405)
MBS6445793-02 5x 0.1 mL

Complement Component 1R (C1r) (MaxLight 405)

Sign In for Pricing
View Details
FLI1 Cell-Based ELISA Kit
CB5270 1 Kit

FLI1 Cell-Based ELISA Kit

Sign In for Pricing
View Details
Cow Alpha Hemoglobin Stabilizing Protein (AHSP) ELISA Kit
abx512879 96 Tests

Cow Alpha Hemoglobin Stabilizing Protein (AHSP) ELISA Kit

Sign In for Pricing
View Details
Human Vam6/Vps39-like protein, VPS39 ELISA KIT
ELI-40230h 96 Tests

Human Vam6/Vps39-like protein, VPS39 ELISA KIT

Sign In for Pricing
View Details
Brachyury (Brachyury Homolog, Brachyury Protein, Bry, MGC104817, T, T Protein, TFT) (MaxLight 490)
B2674-75A-ML490 100 µL

Brachyury (Brachyury Homolog, Brachyury Protein, Bry, MGC104817, T, T Protein, TFT) (MaxLight 490)

Sign In for Pricing
View Details