Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hevea brasiliensis Pro-hevein (HEV1)

Product Specifications

Product Name Alternative

Major hevein

Abbreviation

Recombinant Hevea brasiliensis HEV1 protein

Gene Name

HEV1

UniProt

P02877

Expression Region

18-204aa

Organism

Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)

Target Sequence

EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.

Molecular Weight

24.1 kDa

References & Citations

"Wound-induced accumulation of mRNA containing a hevein sequence in laticifers of rubber tree (Hevea brasiliensis) ." Broekaert W.F., Lee H.I., Kush A., Chua N.H., Raikhel N. Proc. Natl. Acad. Sci. U.S.A. 87:7633-7637 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgm1 Mouse Gene Knockout Kit (CRISPR)
KN517495 1 Kit

Tgm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL
BNC940499-500 1x 500 µL

Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS806517 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
PSMD12 Polyclonal Antibody
E-AB-52752-01 20 µL

PSMD12 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD12 Polyclonal Antibody
E-AB-52752-02 60 µL

PSMD12 Polyclonal Antibody

Sign In for Pricing
View Details
PSMD12 Polyclonal Antibody
E-AB-52752-03 120 µL

PSMD12 Polyclonal Antibody

Sign In for Pricing
View Details