Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial

Product Specifications

Product Name Alternative

CD_antigen: CD124

Abbreviation

Recombinant Pig IL4R protein, partial

Gene Name

IL4R

UniProt

Q863Z5

Expression Region

33-240aa

Organism

Sus scrofa (Pig)

Target Sequence

VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2 (By similarity) .

Molecular Weight

28.2 kDa

References & Citations

"Molecular cloning of the swine IL-4 receptor alpha and IL-13 receptor alpha 1 chains: effects of experimental Toxoplasma gondii and Ascaris suum infections on tissue mRNA levels." Zarlenga D.S. Jr., Dawson H., Solano-Aguilar G., Urban J.F. Jr. Submitted (MAR-2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Riders
1110834/1 1 Each

Riders

Sign In for Pricing
View Details
IPCEF1 Protein Vector (Mouse) (pPM-C-His)
PV192053 500 ng

IPCEF1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Phospholipase D (pld)
MBS1409264-01 0.02 mg (E-Coli)

Recombinant Rickettsia bellii Phospholipase D (pld)

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Phospholipase D (pld)
MBS1409264-02 0.1 mg (E-Coli)

Recombinant Rickettsia bellii Phospholipase D (pld)

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Phospholipase D (pld)
MBS1409264-03 0.02 mg (Yeast)

Recombinant Rickettsia bellii Phospholipase D (pld)

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Phospholipase D (pld)
MBS1409264-04 0.1 mg (Yeast)

Recombinant Rickettsia bellii Phospholipase D (pld)

Sign In for Pricing
View Details