Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39)

Product Specifications

Product Name Alternative

P39; Major capsid protein

Abbreviation

Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein

Gene Name

P39

UniProt

P35840

Expression Region

1-356aa

Organism

Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV)

Target Sequence

MALVSGALSTNRLRNYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIEKMVLPIPDAEGNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTHMIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFNRTSAILAMTNPRRYCSQVNSNYARIWTTDDVNVAGNVFESMPPFLKNLINVAVAPEQIMIDEKTLVIRNCPTCNIDDSGLVANVQLYNPVVPRYRSTFNENVLHVENVLKFKGNANALQKSLSRYEPYPIVVPLMLGTQTLNTSSAYKQFTVPTRDDFAALNQRTGAAAAAPPAPAAAPAGPRPAAELEYDETLDRFARWRAR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Expressed late in infection.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.6 kDa

References & Citations

"Nucleotide sequence of the p39-capsid gene region of the Lymantria dispar nuclear polyhedrosis virus." Bjoernson R.M., Rohrmann G.F. J. Gen. Virol. 73:1505-1508 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 8, ID (AP) discontinued
C2087-33B-AP 100 µL

Caspase 8, ID (AP) discontinued

Sign In for Pricing
View Details
Phospho-ADRB2 (S355/S356) Antibody
A20315-100UG 100 µg

Phospho-ADRB2 (S355/S356) Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD48 Antibody (HM48-1)
FITC-30023U-01 25 µg

FITC Anti-Mouse CD48 Antibody (HM48-1)

Sign In for Pricing
View Details
FITC Anti-Mouse CD48 Antibody (HM48-1)
FITC-30023U-02 100 µg

FITC Anti-Mouse CD48 Antibody (HM48-1)

Sign In for Pricing
View Details
ABHD16B (NM_080622) Human Over-expression Lysate
LS140701-100ug 100 µg

ABHD16B (NM_080622) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Anti-glucoprotein 210,GP210 ELISA KIT
JOT-EKD0476Hu 96 wells

Human Anti-glucoprotein 210,GP210 ELISA KIT

Sign In for Pricing
View Details