Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Borrelia burgdorferi Outer surface protein A (ospA)

Product Specifications

Product Name Alternative

OspA; Outer surface protein A

Abbreviation

Recombinant Borreliella burgdorferi ospA protein

Gene Name

OspA

UniProt

P0A3N6

Expression Region

17-273aa

Organism

Borreliella burgdorferi (Lyme disease spirochete) (Borrelia burgdorferi)

Target Sequence

CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.9 kDa

References & Citations

"An OspA serotyping system for Borrelia burgdorferi based on reactivity with monoclonal antibodies and OspA sequence analysis." Zumstein G., Fuchs R., Hofmann A., Preac-Mursic V., Soutschek E., Wilske B. J. Clin. Microbiol. 31:340-350 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]
TA501117AM 100 µL

NME4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Two Component PCR Plates
P9096-HSW 50 Units/Pack

Two Component PCR Plates

Sign In for Pricing
View Details
FAM115C (TCAF2) Human qPCR Primer Pair (NM_173678)
HP218461 200 Reactions

FAM115C (TCAF2) Human qPCR Primer Pair (NM_173678)

Sign In for Pricing
View Details
RTF1 (NM_015138) Human Over-expression Lysate
LC432360 20 µg

RTF1 (NM_015138) Human Over-expression Lysate

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2364), CF488A conjugate, 0.1mg/mL
BNC882364-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/2364), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
YWHAH antibody
FNab09576 100 µg

YWHAH antibody

Sign In for Pricing
View Details