Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Absidia glauca Actin-1 (ACT1), partial

Product Specifications

Product Name Alternative

ACT1Actin-1; Fragment

Abbreviation

Recombinant Absidia glauca ACT1 protein, partial

Gene Name

ACT1

UniProt

P10982

Expression Region

1-140aa

Organism

Absidia glauca (Pin mould)

Target Sequence

MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tex264 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7178407 1.0 µg DNA

Tex264 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)
MBS1406611-01 0.02 mg (E-Coli)

Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)

Sign In for Pricing
View Details
Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)
MBS1406611-02 0.02 mg (Yeast)

Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)

Sign In for Pricing
View Details
Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)
MBS1406611-03 0.1 mg (E-Coli)

Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)

Sign In for Pricing
View Details
Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)
MBS1406611-04 0.1 mg (Yeast)

Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)

Sign In for Pricing
View Details
Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)
MBS1406611-05 0.02 mg (Baculovirus)

Recombinant Human Rho GTPase-activating protein 15 (ARHGAP15)

Sign In for Pricing
View Details